{"product_id":"proteintech-86440-1-rr","title":"Proteintech, 86440-1-RR, TMCO1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe TMCO1 (86440-1-RR) by Proteintech is a Recombinant antibody targeting TMCO1 in WB, IHC, ELISA applications with reactivity to human samples\n86440-1-RR targets TMCO1 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, L02 cells,  Calu-3 cells,  MDA-MB-231 cells\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTMCO1, also known as TMCC4, PNAS-10, and PNAS-136, is a 188 amino acid protein, which is widely expressed in adult and fetal tissues, with higher levels in thymus, prostate, testis and small intestine and lower levels in brain, placenta, lung and kidney (PubMed:10393320, PubMed:20018682). TMCO1 as a Calcium-selective channel is required to prevent calcium stores from overfilling, thereby playing a key role in calcium homeostasis (PubMed:27212239). In response to endoplasmic reticulum overloading, TMCO1, assembles into a homotetramer, forming a functional calcium-selective channel, regulating the calcium content in endoplasmic reticulum store (PubMed:27212239).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag26278 Product name: Recombinant human TMCO1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 111-188 aa of NM_019026 Sequence: MGRVVAKLPFTPLSYIQGLSHRNLLGDDTTDCSFIFLYILCTMSIRQNIQKILGLAPSRAATKQAGGFLGPPPPSGKFS Predict reactive species\nFull Name: transmembrane and coiled-coil domains 1\nCalculated Molecular Weight: 21 kDa\nObserved Molecular Weight: 20 kDa\nGenBank Accession Number: NM_019026\nGene Symbol: TMCO1\nGene ID (NCBI): 54499\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9UM00\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888832925865,"sku":"86440-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-86440-1-rr","provider":"Iright","version":"1.0","type":"link"}