{"product_id":"proteintech-86446-1-rr","title":"Proteintech, 86446-1-RR, SNX29 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe SNX29 (86446-1-RR) by Proteintech is a Recombinant antibody targeting SNX29 in WB, ELISA applications with reactivity to human samples\n86446-1-RR targets SNX29 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSorting nexins are a diverse group of cytoplasmic and membrane-associated proteins classified by the presence of a phospholipid-binding motif PX domain (PMID:12461558). They are involved in endocytosis and protein trafficking. SNX29 (Sorting nexin 29) is associated with  bipolar disorder (BPD) and major depressive disorder (MDD) in the Han population (PMID: 33143498).  The expression of SNX29 is significantly upregulated in most tumor tissues, and its expression is associated with the progression, immune infiltration and drug sensitivity of various cancers (PMID: 36829159).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag32618 Product name: Recombinant human SNX29 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-150 aa of XM_011522738 Sequence: MSGSQNNDKRQFLLERLLDAVKQCQIRFGGRKEIASDSDSRVTCLCAQFEAVLQHGLKRSRGLALTAAAIKQAAGFASKTETEPVFWYYVKEVLNKHELQRFYSLRHIASDVGRGRAWLRCALNEHSLERYLHMLLADRCRLSTFYEDWS Predict reactive species\nFull Name: sorting nexin 29\nCalculated Molecular Weight: 91kd\nObserved Molecular Weight: 90 kDa\nGenBank Accession Number: XM_011522738\nGene Symbol: SNX29\nGene ID (NCBI): 92017\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q8TEQ0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888825290921,"sku":"86446-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-86446-1-rr","provider":"Iright","version":"1.0","type":"link"}