{"product_id":"proteintech-86473-3-rr","title":"Proteintech, 86473-3-RR, BAF170 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe BAF170 (86473-3-RR) by Proteintech is a Recombinant antibody targeting BAF170 in WB, ELISA applications with reactivity to human, mouse, rat samples\n86473-3-RR targets BAF170 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells, A431 cells,  HeLa cells,  RAW 264.7 cells,  C6 cells,  NIH\/3T3 cells,  PC-12 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBAF170, also named as SWI\/SNF complex 170 kDa subunit or SMARCC2, is a 1214 amino acid protein, which belongs to the SMARCC family. BAF170 is ubiquitously expressed. BAF170 is involved in transcriptional activation and repression of select genes by chromatin remodeling. BAF170 may be required for CoREST dependent repression of neuronal specific gene promoters in non-neuronal cells. BAF170 belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and the neuron-specific chromatin remodeling complex (nBAF complex). The calcualted molecular weight of BAF170, is 133 kDa, but modified BAF170 is about 170 kDa. (PMID: 8804307)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag2634 Product name: Recombinant human BAF170 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 300-647 aa of BC013045 Sequence: KRSPSPSPTPEAKKKNAKKGPSTPYTKSKRGHREEEQEDLTKDMDEPSPVPNVEEVTLPKTVNTKKDSESAPVKGGTMTDLDEQEDESMETTGKDEDENSTGNKGEQTKNPDLHEDNVTEQTHHIIIPSYAAWFDYNSVHAIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLAGDVCAIMRVHAFLEQWGLINYQVDAESRPTPMGPPPTSHFHVLADTPSGLVPLQPKTPQGRQVDADTKAGRKGKELDDLVPETAKGKPELQTSASQQMLNFPDKGKEKPTDMQNFGLRTDMYTKKNVPSKSKAAASATREWTEQETLLLLEALEMY Predict reactive species\nFull Name: SWI\/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 2\nCalculated Molecular Weight: 1214 aa, 132 kDa\nObserved Molecular Weight: 170 kDa\nGenBank Accession Number: BC013045\nGene Symbol: BAF170\nGene ID (NCBI): 6601\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q8TAQ2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888710668457,"sku":"86473-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-86473-3-rr","provider":"Iright","version":"1.0","type":"link"}