{"product_id":"proteintech-86484-1-rr","title":"Proteintech, 86484-1-RR, B7-H4 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe B7-H4 (86484-1-RR) by Proteintech is a Recombinant antibody targeting B7-H4 in WB, ELISA applications with reactivity to mouse, rat samples\n86484-1-RR targets B7-H4 in WB, ELISA applications and shows reactivity with mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat liver tissue, rat uterus tissue,  rat pancreas tissue,  mouse liver tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nB7-H4, also named VTCN1, B7X, or B7S1, is a single-pass type I membrane protein, which contains two immunoglobulin-like domains and belongs to the immunoglobulin superfamily. B7-H4 negatively regulates T-cell mediated immune response by inhibiting T-cell activation, proliferation, cytokine production and development of cytotoxicity. B7-H4 is over-expressed in many cancers, including breast, ovarian, endometrial, renal cell and non-small-cell lung cancers. The predicted molecular weight of B7‑H4 is 31 kDa. The glycosylated B7‑H4 is 50 to 80 kDa, and the non-glycosylated form is 28 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg3230 Product name: Recombinant Rat B7-H4 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 29-257 aa of NM_001024244.1 Sequence: FGISGKHFITVTTFTSAGNIGEDGTLSCTFEPDIKLNGIVIQWLKEGIKGLVHEFKEGKDDLSQQHEMFRGRTAVFADQVVVGNASLRLKNVQLTDAGTYTCYIHTSKGKGNANLEYKTGAFSMPEINVDYNASSESLRCEAPRWFPQPTVAWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTDSEVKRRSQLELLNSG Predict reactive species\nFull Name: V-set domain containing T cell activation inhibitor 1\nCalculated Molecular Weight: 31 kDa\nObserved Molecular Weight: 75 kDa\nGenBank Accession Number: NM_001024244.1\nGene Symbol: Vtcn1\nGene ID (NCBI): 295322\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q501W4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888710602921,"sku":"86484-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-86484-1-rr","provider":"Iright","version":"1.0","type":"link"}