{"product_id":"proteintech-86509-1-rr","title":"Proteintech, 86509-1-RR, F2RL3 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe F2RL3 (86509-1-RR) by Proteintech is a Recombinant antibody targeting F2RL3 in WB, ELISA applications with reactivity to human, mouse, rat samples\n86509-1-RR targets F2RL3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse pancreas tissue, rat pancreas tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCoagulation factor II receptor-like 3 (F2RL3) encodes a member of the protease-activated receptor subfamily, also known as protease-activated receptor 4  (PAR4), which takes partin platelet activation, intimal hyperplasia and inflammation (PMID:34284820). An absence of PAR4 in mouse models results in impaired hemostasis and a protection against pulmonary embolism, and a small number of missense coding variants in F2RL3 that alter platelet aggregation and function have been described(PMID:35012325).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag13624 Product name: Recombinant human F2RL3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 305-385 aa of BC074782 Sequence: LHYSDPSPSAWGNLYGAYVPSLALSTLNSCVDPFIYYYVSAEFRDKVRAGLFQRSPGDTVASKASAEGGSRGMGTHSSLLQ Predict reactive species\nFull Name: coagulation factor II (thrombin) receptor-like 3\nCalculated Molecular Weight: 385 aa, 41 kDa\nObserved Molecular Weight: 45 kDa\nGenBank Accession Number: BC074782\nGene Symbol: F2RL3\nGene ID (NCBI): 9002\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q96RI0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888743305385,"sku":"86509-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-86509-1-rr","provider":"Iright","version":"1.0","type":"link"}