{"product_id":"proteintech-86580-1-rr","title":"Proteintech, 86580-1-RR, Syntaxin 8 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe Syntaxin 8 (86580-1-RR) by Proteintech is a Recombinant antibody targeting Syntaxin 8 in WB, ELISA applications with reactivity to human, mouse, rat samples\n86580-1-RR targets Syntaxin 8 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, SH-SY5Y cells,  mouse brain tissue,  rat brain tissue,  fetal human brain tissue,  human placenta tissue,  mouse pancreas tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSyntaxin 8 (STX8), also known as CIP-1-associated regulator of cyclin B (CARB ), is a protein belonging to the syntaxin family. The gene of STX8 maps to chromosomal band 17p12 and it encodes a 236-amino-acid protein containing 1 t-SNARE coiled-coil homology domain. STX8 mRNA is broadly expressed in multiple human tissues, including the heart, brain, kidney, liver, lung, placenta, skeletal muscle, spleen, and pancreas (PMID: 10198254). STX8 is involved in protein trafficking from early to late endosomes via vesicle fusion and exocytosis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag2850 Product name: Recombinant human STX8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-211 aa of BC009713 Sequence: MAPDPWFSTYDSTCQIAQEIAEKIQQRNQYERKGEKAPKLTVTIRALLQNLKEKIALLKDLLLRAVSTHQITQLEGDRRQNLLDDLVTRERLLLASFKNEGAEPDLIRSSLMSEEAKRGAPNPWLFEEPEETRGLGFDEIRQQQQKIIQEQDAGLDALSSIISRQKQMGQEIGNELDEQNEIIDDLANLVENTDEKLRNETRRVNMVDRKS Predict reactive species\nFull Name: syntaxin 8\nCalculated Molecular Weight: 236 aa, 27 kDa\nObserved Molecular Weight: 25 kDa\nGenBank Accession Number: BC009713\nGene Symbol: Syntaxin 8\nGene ID (NCBI): 9482\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9UNK0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888828993705,"sku":"86580-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-86580-1-rr","provider":"Iright","version":"1.0","type":"link"}