{"product_id":"proteintech-86584-2-rr","title":"Proteintech, 86584-2-RR, OMG Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe OMG (86584-2-RR) by Proteintech is a Recombinant antibody targeting OMG in WB, ELISA applications with reactivity to human samples\n86584-2-RR targets OMG in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue,  mouse spinal cord tissue,  rat spinal cord tissue,  mouse cerebellum tissue,  rat cerebellum tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nOMG (oligodendrocyte myelin glycoprotein), also known as OMGP. It is expected to be located in cell membrane, the protein is mainly expressed in the central nervous system in both neurons and oligodendrocytes. The calculated molecular weight of OMG is 50 kDa, and o-glycosylated in its Ser\/Thr-rich repeat domain. It is also a cell adhesion molecule contributing to the interactive process required for myelination in the central nervous system. Axonal regeneration in the adult spinal cord is thought to be at least partially blocked after injury by inhibitory myelin components, including Nogo, myelin associated glycoprotein (MAG) and oligodendrocyte-myelin glycoprotein (OMGP).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg5825 Product name: Recombinant human OMGP protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 25-417 aa of NM_002544.5 Sequence: ICPLQCICTERHRHVDCSGRNLSTLPSGLQENIIHLNLSYNHFTDLHNQLTQYTNLRTLDISNNRLESLPAHLPRSLWNMSAANNNIKLLDKSDTAYQWNLKYLDVSKNMLEKVVLIKNTLRSLEVLNLSSNKLWTVPTNMPSKLHIVDLSNNSLTQILPGTLINLTNLTHLYLHNNKFTFIPDQSFDQLFQLQEITLYNNRWSCDHKQNITYLLKWMMETKAHVIGTPCSTQISSLKEHNMYPTPSGFTSSLFTVSGMQTVDTINSLSVVTQPKVTKIPKQYRTKETTFGATLSKDTTFTSTDKAFVPYPEDTSTETINSHEAAAATLTIHLQDGMVTNTSLTSSTKSSPTPMTLSITSGMPNNFSEMPQQSTTLNLWREETTTNVKTPLPS Predict reactive species\nFull Name: oligodendrocyte myelin glycoprotein\nCalculated Molecular Weight: 50 kDa\nObserved Molecular Weight: 110-130 kDa\nGenBank Accession Number: NM_002544.5\nGene Symbol: OMG\nGene ID (NCBI): 4974\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P23515\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888793931945,"sku":"86584-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-86584-2-rr","provider":"Iright","version":"1.0","type":"link"}