{"product_id":"proteintech-86651-1-rr","title":"Proteintech, 86651-1-RR, Nucleoside phosphorylase Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe Nucleoside phosphorylase (86651-1-RR) by Proteintech is a Recombinant antibody targeting Nucleoside phosphorylase in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n86651-1-RR targets Nucleoside phosphorylase in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, K-562 cells,  U-937 cells,  HL-60 cells,  Raji cells,  NIH\/3T3 cells,  rat spleen tissue\nPositive IF\/ICC detected in: NIH\/3T3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPurine nucleoside phosphorylases (PNP) is a ubiquitous enzyme of purine metabolism that functions in the salvage pathway, including even those of protozoan parasites, thus enabling the cells to utilize purine bases recovered from metabolized purine ribo- and deoxyribonucleosides to synthesize purine nucleotides (PMID: 11337031, 23332162). PNP deficiency in humans leads to an impairment of T-cell function, usually with no apparent effects on B-cell function. hPNP is widely distributed in various tissues and cells of the human body, with the highest activity in kidney, peripheral lymphocytes and granulocytes (PMID: 38701712).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag12507 Product name: Recombinant human NP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-289 aa of BC106074 Sequence: MENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYGEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS Predict reactive species\nFull Name: nucleoside phosphorylase\nCalculated Molecular Weight: 289 aa, 32 kDa\nObserved Molecular Weight: 32 kDa\nGenBank Accession Number: BC106074\nGene Symbol: Purine nucleoside phosphorylase\nGene ID (NCBI): 4860\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P00491\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888793079977,"sku":"86651-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-86651-1-rr","provider":"Iright","version":"1.0","type":"link"}