{"product_id":"proteintech-86663-4-rr","title":"Proteintech, 86663-4-RR, RHOB Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe RHOB (86663-4-RR) by Proteintech is a Recombinant antibody targeting RHOB in WB, ELISA applications with reactivity to human, mouse, rat samples\n86663-4-RR targets RHOB in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, A549 cells,  HEK-293 cells,  COLO 205 cells,  SH-SY5Y cells,  mouse brain tissue,  rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRho-related GTP-binding protein RhoB (RHOB) is also named ARH6, ARHB and Rho cDNA clone 6 (h6). RhoB was the first member of the Rho family to be implicated in endosomal trafficking. One study showed that RhoB localizes and activates its downstream target, serine\/threonine kinase (PRK1), on endosomes, and acts through this signaling pathway to disrupt the trafficking of internalized EGF receptor from endosomes to a prelysosomal compartment (PMID: 29385717). RhoB is known to be part of the immediate early genetic response to epidermal growth factor, transforming growth factor β, Src activation, or genotoxic stress (PMID:9545335, PMID: 10679283). RhoB was shown to have potential implications for EGF signaling by targeting the activated EGF receptors to the lysosome, which represents an \"off-switch\" for mitogenic signals (PMID: 1050858). RhoB was also demonstrated to exert a negative regulatory influence on TGF-β-induced transcriptional activation (PMID:9545335). The activity of the RhoB promoter was stimulated by genotoxic treatments indicating its role in the cellular response to DNA damage (PMID:9388198).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag5593 Product name: Recombinant human RHOB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-196 aa of BC066954 Sequence: MAAIRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQKRYGSQNGCINCCKVL Predict reactive species\nFull Name: ras homolog gene family, member B\nCalculated Molecular Weight: 22 kDa\nObserved Molecular Weight: 22 kDa\nGenBank Accession Number: BC066954\nGene Symbol: RHOB\nGene ID (NCBI): 388\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P62745\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888814837929,"sku":"86663-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-86663-4-rr","provider":"Iright","version":"1.0","type":"link"}