{"product_id":"proteintech-86696-1-rr","title":"Proteintech, 86696-1-RR, KCNIP2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe KCNIP2 (86696-1-RR) by Proteintech is a Recombinant antibody targeting KCNIP2 in WB, ELISA applications with reactivity to human, mouse, rat samples\n86696-1-RR targets KCNIP2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKCNIP2 is a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belongs to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified from this gene.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag14111 Product name: Recombinant human KCNIP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-70 aa of BC034685 Sequence: MRGQGRKESLSDSRDLDGSYDQLTGHPPGPTKKALKQRFLKLLPCCGPQALPSVSENSVDDEFELSTVCH Predict reactive species\nFull Name: Kv channel interacting protein 2\nCalculated Molecular Weight: 270 aa, 31 kDa\nObserved Molecular Weight: 31-35 kDa\nGenBank Accession Number: BC034685\nGene Symbol: KCNIP2\nGene ID (NCBI): 30819\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9NS61\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888646213801,"sku":"86696-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-86696-1-rr","provider":"Iright","version":"1.0","type":"link"}