{"product_id":"proteintech-86709-1-rr","title":"Proteintech, 86709-1-RR, Cyclophilin A Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe Cyclophilin A (86709-1-RR) by Proteintech is a Recombinant antibody targeting Cyclophilin A in WB, ELISA applications with reactivity to human, mouse, rat samples\n86709-1-RR targets Cyclophilin A in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  Jurkat cells,  K-562 cells,  NIH\/3T3 cells,  C6 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCyclophilin A, also named as PPIA and Rotamase A, belongs to the cyclophilin-type PPIase family and PPIase A subfamily. PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. PPIA forms a trimolecular complex with cyclophilin and calcineurins to inhibit calcineurin phosphatase activity. PPIA is incorporated into the virion of the type 1 human immunodeficiency virus (HIV-1) via a direct interaction with the capsid domain of the viral Gag polyprotein and is crucial for efficient viral replication.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag1120 Product name: Recombinant human CYPA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-165 aa of BC005320 Sequence: MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE Predict reactive species\nFull Name: peptidylprolyl isomerase A (cyclophilin A)\nCalculated Molecular Weight: 18 kDa\nObserved Molecular Weight: 18 kDa\nGenBank Accession Number: BC005320\nGene Symbol: PPIA\nGene ID (NCBI): 5478\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P62937\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888732164265,"sku":"86709-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-86709-1-rr","provider":"Iright","version":"1.0","type":"link"}