{"product_id":"proteintech-86715-1-rr","title":"Proteintech, 86715-1-RR, EDIL3 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe EDIL3 (86715-1-RR) by Proteintech is a Recombinant antibody targeting EDIL3 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n86715-1-RR targets EDIL3 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HUVEC cells,  NIH\/3T3 cells,  C6 cells\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEGF-like repeats and discoidin I-like domain-containing protein 3 (EDIL3), also named as DEL1 or integrin-biding protein DEL1, is a 52-kDa extracellular matrix protein produced by endothelial cells in embryos (PMID: 9420328). It is composed of three EGF repeats and two discoidin I-like domains. The second EGF repeat contains an RGD motif. EDIL3 promotes adhesion of endothelial cells through interaction with the alpha-v\/beta-3 integrin receptor. It may be involved in vascular remodeling during angiogenesis (PMID: 12840057; 14981004). EDIL3 has also been reported to be an endogenous inhibitor of inflammatory cell recruitment by interfering with the integrin LFA-1-dependent leukocyte-endothelial adhesion (PMID: 19008446).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag3274 Product name: Recombinant human EDIL3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 131-480 aa of BC030828 Sequence: GGICTDLVANYSCECPGEFMGRNCQYKCSGPLGIEGGIISNQQITASSTHRALFGLQKWYPYYARLNKKGLINAWTAAENDRWPWIQINLQRKMRVTGVITQGAKRIGSPEYIKSYKIAYSNDGKTWAMYKVKGTNEDMVFRGNIDNNTPYANSFTPPIKAQYVRLYPQVCRRHCTLRMELLGCELSGCSEPLGMKSGHIQDYQITASSIFRTLNMDMFTWEPRKARLDKQGKVNAWTSGHNDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKLAYSNDGEHWTVYQDEKQRKDKVFQGNFDNDTHRKNVIDPPIYARHIRILPWSWYGRITLRSELLGCTEEE Predict reactive species\nFull Name: EGF-like repeats and discoidin I-like domains 3\nCalculated Molecular Weight: 52 kDa\nObserved Molecular Weight: 55 kDa\nGenBank Accession Number: BC030828\nGene Symbol: EDIL3\nGene ID (NCBI): 10085\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O43854\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888739012777,"sku":"86715-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-86715-1-rr","provider":"Iright","version":"1.0","type":"link"}