{"product_id":"proteintech-86775-3-rr","title":"Proteintech, 86775-3-RR, HFE2\/Hemojuvelin Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe HFE2\/Hemojuvelin (86775-3-RR) by Proteintech is a Recombinant antibody targeting HFE2\/Hemojuvelin in WB, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n86775-3-RR targets HFE2\/Hemojuvelin in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, HeLa cells,  HepG2 cells,  human platelets,  human skeletal muscle tissue,  human heart tissue,  mouse liver tissue\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHFE2, also known as Hemojuvelin (HJV), is a GPI-anchored protein that binds to new proteins and bone morphogenetic proteins (BMP2 and BMP4) and can be released from the cell membrane. HFE2 plays a key role in the regulation of hepcidin, which regulates the absorption and recycling of iron.(PMID: 17331953; PMID: 17938254)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag2354 Product name: Recombinant human HFE2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 227-426 aa of BC017926 Sequence: MQECIDQKVYQAEVDNLPVAFEDGSINGGDRPGGSSLSIQTANPGNHVEIQAAYIGTTIIIRQTAGQLSFSIKVAEDVAMAFSAEQDLQLCVGGCPPSQRLSRSERNRRGAITIDTARRLCKEGLPVEDAYFHSCVFDVLISGDPNFTVAAQAALEDARAFLPDLEKLHLFPSDAGVPLSSATLLAPLLSGLFVLWLCIQ Predict reactive species\nFull Name: hemochromatosis type 2 (juvenile)\nCalculated Molecular Weight: 426 aa, 45 kDa\nObserved Molecular Weight: 45 kDa\nGenBank Accession Number: BC017926\nGene Symbol: HFE2\nGene ID (NCBI): 148738\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q6ZVN8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888761360553,"sku":"86775-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-86775-3-rr","provider":"Iright","version":"1.0","type":"link"}