{"product_id":"proteintech-86802-1-rr","title":"Proteintech, 86802-1-RR, TMED9 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe TMED9 (86802-1-RR) by Proteintech is a Recombinant antibody targeting TMED9 in WB, ELISA applications with reactivity to human, mouse, rat samples\n86802-1-RR targets TMED9 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PC-12 cells, MCF-7 cells,  OVCAR-3 cells,  A2780 cells,  HepG2 cells,  NIH\/3T3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTMED9 (also named as GMP25, GP25L2 or p25) is a member of the EMP24\/GP25L family. TMED9 probably forms hetero-oligomeric complexes with TMED7 (p27), TMED2 (p24), and TMED10 (p23) (PMID: 10359607). Located in the endoplasmic reticulum and the Golgi, TMED9 appears to be involved in vesicular protein trafficking, mainly in the early secretory pathway (PMID: 9472029; 10359607).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag13813 Product name: Recombinant human TMED9 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-224 aa of BC001123 Sequence: MAVELGVLLVRPRPGTGLGRVMRTLLLVLWLATRGSALYFHIGETEKKCFIEEIPDETMVIGNYRTQLYDKQREEYQPATPGLGMFVEVKDPEDKVILARQYGSEGRFTFTSHTPGEHQICLHSNSTKFSLFAGGMLRVHLDIQVGEHANDYAEIAAKDKLSELQLRVRQLVEQVEQIQKEQNYQRWREERFRQTSESTNQRVLWWSILQTLILVAIGVWQMRH Predict reactive species\nFull Name: transmembrane emp24 protein transport domain containing 9\nCalculated Molecular Weight: 235 aa, 27 kDa\nObserved Molecular Weight: 24-27 kDa\nGenBank Accession Number: BC001123\nGene Symbol: TMED9\nGene ID (NCBI): 54732\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9BVK6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888833056937,"sku":"86802-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-86802-1-rr","provider":"Iright","version":"1.0","type":"link"}