{"product_id":"proteintech-86817-1-rr","title":"Proteintech, 86817-1-RR, ACP1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe ACP1 (86817-1-RR) by Proteintech is a Recombinant antibody targeting ACP1 in WB, ELISA applications with reactivity to human, mouse, rat samples\n86817-1-RR targets ACP1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, HEK-293 cells,  HeLa cells,  K-562 cells,  RAW 264.7 cells,  NIH\/3T3 cells,  PC-12 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAcid phosphatase 1 (ACP1) is a low-molecular-weight phosphotyrosine protein phosphatase known to participate in various cellular processes, including signal transduction, proliferation, and metabolism. It functions by dephosphorylating tyrosine-phosphorylated proteins, thereby modulating receptor-mediated signaling pathways.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag17539 Product name: Recombinant human ACP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 15-102 aa of BC007422 Sequence: GNICRSPIAEAVFRKLVTDQNISENWVIDSGAVSDWNVGRSPDPRAVSCLRNHGIHTAHKARQITKEDFATFDYILCMDESNLRDLNR Predict reactive species\nFull Name: acid phosphatase 1, soluble\nCalculated Molecular Weight: 158 aa, 18 kDa\nObserved Molecular Weight: 18 kDa\nGenBank Accession Number: BC007422\nGene Symbol: ACP1\nGene ID (NCBI): 52\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P24666\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888688812201,"sku":"86817-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-86817-1-rr","provider":"Iright","version":"1.0","type":"link"}