{"product_id":"proteintech-86851-1-rr","title":"Proteintech, 86851-1-RR, HBG1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe HBG1 (86851-1-RR) by Proteintech is a Recombinant antibody targeting HBG1 in WB, ELISA applications with reactivity to human samples\n86851-1-RR targets HBG1 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEL cells, K-562 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHBG1, also named as Hb F Agamma, HBGA, HBGR and HSGGL, belongs to the globin family. HBG1 makes up the fetal hemoglobin F, in combination with alpha chains. Some gamma variants can cause severe jaundice and cyanosis in premature and new born babies. The antibody is specific to HBG1 and HBG2. The antibody has no cross reaction to HBB and HBD. HBG1 protein migrates around 16 kDa. Heterodimer of 32 kDa may also be observed. This antibody could identify HBG1 and HBG2.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag22776 Product name: Recombinant human HBG1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-118 aa of BC010913 Sequence: MGHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVLTSLGDATKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIH Predict reactive species\nFull Name: hemoglobin, gamma A\nCalculated Molecular Weight: 147 aa, 16 kDa\nObserved Molecular Weight: 14-16 kDa\nGenBank Accession Number: BC010913\nGene Symbol: HBG1\nGene ID (NCBI): 3047\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P69891\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888760082601,"sku":"86851-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-86851-1-rr","provider":"Iright","version":"1.0","type":"link"}