{"product_id":"proteintech-86879-3-rr","title":"Proteintech, 86879-3-RR, HBZ Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe HBZ (86879-3-RR) by Proteintech is a Recombinant antibody targeting HBZ in WB, IF\/ICC, ELISA applications with reactivity to human samples\n86879-3-RR targets HBZ in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells\nPositive IF\/ICC detected in: K-562 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHBZ, also named as Zeta-globin and HBAZ, belongs to the globin family. HBZ is an alpha-type chain of mammalian embryonic hemoglobin, synthesized primarily in the yolk sac. HBZ was first identified as an antisense viral protein that associated with cAMP-response element binding protein-2 (CREB-2) in HTLV-1-infected cells. HBZ is the only viral gene that is expressed in all ATL cases (PMID: 22787458). ShRNA repression of HBZ expression in established HTLV-1-transformed cell lines and newly immortalized T-lymphocytes also significantly suppressed T-lymphocyte proliferation (PMID: 19650892, 16917009).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag11061 Product name: Recombinant human HBZ protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-142 aa of BC027892 Sequence: MSLTKTERTIIVSMWAKISTQADTIGTETLERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDAVKSIDDIGGALSKLSELHAYILRVDPVNFKLLSHCLLVTLAARFPADFTAEAHAAWDKFLSVVSSVLTEKYR Predict reactive species\nFull Name: hemoglobin, zeta\nCalculated Molecular Weight: 142 aa, 16 kDa\nObserved Molecular Weight: 16 kDa\nGenBank Accession Number: BC027892\nGene Symbol: HBZ\nGene ID (NCBI): 3050\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P02008\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888760148137,"sku":"86879-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-86879-3-rr","provider":"Iright","version":"1.0","type":"link"}