{"product_id":"proteintech-86895-1-rr","title":"Proteintech, 86895-1-RR, C1orf124 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe C1orf124 (86895-1-RR) by Proteintech is a Recombinant antibody targeting C1orf124 in WB, ELISA applications with reactivity to human samples\n86895-1-RR targets C1orf124 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSpartan (Protein with SprT-like domain at the N terminus), also known as DVC1 or C1orf124, is a replication-coupled DNA-dependent metalloprotease that cleaves proteins cross-linked to DNA to promote DPC repair (PMID: 38600235). Spartan protease activity is stimulated by DNA binding, while posttranslational modification of Spartan governs both its protease activity and recruitment to the DPC on chromatin (PMID: 27871366). The regulation of Spartan includes a ubiquitin switch (where deubiquitination activates its proteolytic activity), and acetylation and phosphorylation switches (which facilitate DNA binding). The calculated molecular weight of Spartan is 55 kDa, while the 65-kDa band could be due to posttranslational modification (PMID: 33567341, 31316063).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag20586 Product name: Recombinant human C1orf124 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-243 aa of BC015740 Sequence: MDDDLMLALRLQEEWNLQEAERDHAQESLSLVDASWELVDPTPDLQALFVQFNDQFFWGQLEAVEVKWSVRMTLCAGICSYEGKGGMCSIRLSEPLLKLRPRKDLVETLLHEMIHAYLFVTNNDKDREGHGPEFCKHMHRINSLTGANITVYHTFHDEVDEYRRHWWRCNGPCQHRPPYYGYVKRATNREPSAHDYWWAEHQKTCGGTYIKIKEPENYSKKGKGKAKLGKEPVLAAENKGTFV Predict reactive species\nFull Name: DNA-dependent metalloprotease SPRTN\nCalculated Molecular Weight: 489 aa, 55 kDa\nObserved Molecular Weight: 55\/65 kDa\nGenBank Accession Number: BC015740\nGene Symbol: Spartan\nGene ID (NCBI): 83932\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9H040\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888713814185,"sku":"86895-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-86895-1-rr","provider":"Iright","version":"1.0","type":"link"}