{"product_id":"proteintech-86958-2-rr","title":"Proteintech, 86958-2-RR, TRBC1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe TRBC1 (86958-2-RR) by Proteintech is a Recombinant antibody targeting TRBC1 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n86958-2-RR targets TRBC1 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells\nPositive IF\/ICC detected in: Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTRBC1 (T-cell receptor beta constant 1) is a protein encoded by the TRBC1 gene. It constitutes one of the two beta-chain constant regions (TRBC1 and TRBC2) within the T-cell receptor (TCR) complex, which is essential for adaptive immune responses .\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg7272 Product name: Recombinant human TRBC1 protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 1-129 aa of \/ Sequence: DLNKVFPPEVAVFEPSEAEISHTQKATLVCLATGFFPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD Predict reactive species\nFull Name: T cell receptor beta constant 1\nCalculated Molecular Weight: 20 kDa\nObserved Molecular Weight: 40 kDa\nGenBank Accession Number: \/\nGene Symbol: TRBC1\nGene ID (NCBI): 28639\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P01850\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888835678377,"sku":"86958-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-86958-2-rr","provider":"Iright","version":"1.0","type":"link"}