{"product_id":"proteintech-86970-1-rr","title":"Proteintech, 86970-1-RR, KIF7 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe KIF7 (86970-1-RR) by Proteintech is a Recombinant antibody targeting KIF7 in WB, ELISA applications with reactivity to human samples\n86970-1-RR targets KIF7 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  PC-3 cells,  Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKIF7(Kinesin family member 7) is a microtubule interacting protein that functions to regulate Hh signaling by maintaining the architecture of the primary cilium, a complex microtubule-based organelle with many signal transduction functions (PMID: 26439735). KIF7 has been shown to have both negative and positive roles in Shh signal transduction. Without a ligand, KIF7 localizes to the cilium base where it forms a complex with Gli proteins and other pathway components and promotes the processing of GliRs (PMID: 21552264).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag19119 Product name: Recombinant human KIF7 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1214-1332 aa of BC112271 Sequence: VNAVGHSRGGEKRSLCSEGRQAPGNEDELHLAPELLWLSPLTEGAPRTREETRDLVHAPLPLTWKRSSLCGEEQGSPEELRQREAAEPLVGRVLPVGEAGLPWNFGPLSKPRRELRRAS Predict reactive species\nFull Name: kinesin family member 7\nCalculated Molecular Weight: 1343 aa, 151 kDa\nObserved Molecular Weight: 150, 170 kDa\nGenBank Accession Number: BC112271\nGene Symbol: KIF7\nGene ID (NCBI): 374654\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q2M1P5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888774664361,"sku":"86970-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-86970-1-rr","provider":"Iright","version":"1.0","type":"link"}