{"product_id":"proteintech-86975-4-rr","title":"Proteintech, 86975-4-RR, DNAJC5B Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe DNAJC5B (86975-4-RR) by Proteintech is a Recombinant antibody targeting DNAJC5B in WB, ELISA applications with reactivity to human, mouse, rat samples\n86975-4-RR targets DNAJC5B in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat testis tissue, mouse testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDNAJC5B encodes cysteine string proteins (CSP) beta. CSPs belong to the DnaJ-like chaperone family and play an important role in regulated exocytosis in neurons and endocrine cells. Mammals express three CSP proteins, α, β, γ. In contrast to the CSPα which is ubiquitously expressed, CSPβ is restricted to testis and auditory hair cell neurons. The predicted MW of DNAJC5B is around 22 kDa, while some modified forms exist (PMID: 17034881)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag10744 Product name: Recombinant human DNAJC5B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-199 aa of BC016742 Sequence: MACNIPNQRQRTLSTTGEALYEILGLHKGASNEEIKKTYRKLALKHHPDKNPDDPAATEKFKEINNAHAILTDISKRSIYDKYGSLGLYVAEQFGDENVNTYFMLSSWWAKALFVIVGLLTGCYFCCCLCCCCNCCCGHCRPESSVPEEDFYVSPEDLEEQIKSDMEKDVDFPVFLQPTNANEKTQLIKEGSRSYCTDS Predict reactive species\nFull Name: DnaJ (Hsp40) homolog, subfamily C, member 5 beta\nCalculated Molecular Weight: 199 aa, 22 kDa\nObserved Molecular Weight: 22-25 kDa\nGenBank Accession Number: BC016742\nGene Symbol: DNAJC5B\nGene ID (NCBI): 85479\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9UF47\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888736882857,"sku":"86975-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-86975-4-rr","provider":"Iright","version":"1.0","type":"link"}