{"product_id":"proteintech-86980-1-rr","title":"Proteintech, 86980-1-RR, FAM160B1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe FAM160B1 (86980-1-RR) by Proteintech is a Recombinant antibody targeting FAM160B1 in WB, ELISA applications with reactivity to human samples\n86980-1-RR targets FAM160B1 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human testis tissue, PC-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFAM160B1, also named as KIAA1600, is a 765 amino acid protein, which belongs to the UPF0518 family. The biological function of FAM160B1is still non-known. FAM160B1 exists as two isoforms and the molecular weight of isoform one is a 86 kDa protein.The isoforms two is produced by alternative splicing and is a 83 kDa protein. There are modified residues of FAM160B1 protein, so we detected 95 kDa and 100 kDa two bands by western blotting.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag22051 Product name: Recombinant human FAM160B1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 136-319 aa of BC037207 Sequence: IRLCGEVLATPTENEEIQFLCIVCAKLKQDPYLVNFFLENKMKSLASKGVPNVISEDTLKGQDSLSTDTGQSRQPEELSGATGMEQTELEDEPPHQMDHLSTSLDNLSVTSLPEASVVCPNQDYNLVNSLLNLTRSPDGRIAVKACEGLMLLVSLPEPAAAKCLTQSTCLCELLTDRLASLYKA Predict reactive species\nFull Name: family with sequence similarity 160, member B1\nCalculated Molecular Weight: 765 aa, 86 kDa\nObserved Molecular Weight: 100, 130 kDa\nGenBank Accession Number: BC037207\nGene Symbol: FAM160B1\nGene ID (NCBI): 57700\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q5W0V3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888744222889,"sku":"86980-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-86980-1-rr","provider":"Iright","version":"1.0","type":"link"}