{"product_id":"proteintech-87047-1-rr","title":"Proteintech, 87047-1-RR, ABCD3 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe ABCD3 (87047-1-RR) by Proteintech is a Recombinant antibody targeting ABCD3 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n87047-1-RR targets ABCD3 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue, PC-3 cells,  PC-12 cells\nPositive IF\/ICC detected in: PC-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nABCD3 belongs to the superfamily of ATP-binding cassette (ABC) transporters and is a peroxisomal membrane transporter involved in the transport of branched-chain fatty acids and C27 bile acids into the peroxisome. ABCD3 plays a role in the regulation of LCFAs and energy metabolism, namely in the degradation and biosynthesis of fatty acids via beta-oxidation (PMID: 24333844). Mutations in ABCD3 are associated with congenital bile acid synthesis defect 5 (CBAS5)(PMID: 25168382).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag24760 Product name: Recombinant human ABCD3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-124 aa of BC068509 Sequence: MAAFSKYLTARNSSLAGAAFLLLCLLHKRRRALGLHGKKSGKPPLQNNEKEGKKERAVVDKVFFSRLIQILKIMVPRTFCKETGYLVLIAVMLVSRTYCDVWMIQNGTLIESGIIGRSRKDFKR Predict reactive species\nFull Name: ATP-binding cassette, sub-family D (ALD), member 3\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC068509\nGene Symbol: ABCD3\nGene ID (NCBI): 5825\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P28288\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888686583977,"sku":"87047-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-87047-1-rr","provider":"Iright","version":"1.0","type":"link"}