{"product_id":"proteintech-87048-2-rr","title":"Proteintech, 87048-2-RR, NDUFB11 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe NDUFB11 (87048-2-RR) by Proteintech is a Recombinant antibody targeting NDUFB11 in WB, IF\/ICC, ELISA applications with reactivity to human, rat samples\n87048-2-RR targets NDUFB11 in WB, IF\/ICC, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293 cells,  A431 cells,  HepG2 cells,  PC-3 cells,  rat skeletal muscle tissue\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNDUFB11(NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial) is also named as neuronal protein 17.3(Np17.3) and belongs to the complex I NDUFB11 subunit family. This protein is involved in the transfer of electrons from NADH to the respiratory chain and play a role in the growth, maintenance, and survival of neurons. NDUFB11 has 2 isoforms produced by alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag10159 Product name: Recombinant human NDUFB11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 30-163 aa of BC107805 Sequence: ESSFSRTVVAPSAVAGKRPPEPTTPWQEDPEPEDENLYEKNPDSHGYDKDPVLDVWNMRLVFFFGVSIILVLGSTFVAYLPDYRCTGCPRAWDGMKEWSRREAERLVKYREANGLPIMESNCFDPSKIQLPEDE Predict reactive species\nFull Name: NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 11, 17.3kDa\nCalculated Molecular Weight: 163 aa, 18 kDa\nObserved Molecular Weight: 18-20 kDa\nGenBank Accession Number: BC107805\nGene Symbol: NDUFB11\nGene ID (NCBI): 54539\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9NX14\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888789278889,"sku":"87048-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-87048-2-rr","provider":"Iright","version":"1.0","type":"link"}