{"product_id":"proteintech-87060-4-rr","title":"Proteintech, 87060-4-RR, CCL5 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CCL5 (87060-4-RR) by Proteintech is a Recombinant antibody targeting CCL5 in WB, ELISA applications with reactivity to mouse samples\n87060-4-RR targets CCL5 in WB, ELISA applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PMA, LPS and Brefeldin A treated RAW 264.7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCCL5 (C-C motif chemokine ligand 5), also known as RANTES, is a key inflammatory chemokine that attracts immune cells like T cells, monocytes, and eosinophils to sites of infection or inflammation, playing vital roles in immunity, viral defense (including HIV), and sometimes cancer progression, by binding to receptors like CCR1, CCR3, and CCR5 to signal cell movement and activation, with inhibitors being researched for therapeutic use.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg2253 Product name: Recombinant Mouse CCL5 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 24-91 aa of Q5XZF2 Sequence: SPYGSDTTPCCFAYLSLALPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCANPEKKWVQEYINYLEMS Predict reactive species\nFull Name: chemokine (C-C motif) ligand 5\nCalculated Molecular Weight: 10kd\nObserved Molecular Weight: 8 kDa\nGenBank Accession Number: Q5XZF2\nGene Symbol: Ccl5\nGene ID (NCBI): 20304\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P30882\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888599552169,"sku":"87060-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-87060-4-rr","provider":"Iright","version":"1.0","type":"link"}