{"product_id":"proteintech-87095-1-rr","title":"Proteintech, 87095-1-RR, GPR37 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe GPR37 (87095-1-RR) by Proteintech is a Recombinant antibody targeting GPR37 in WB, ELISA applications with reactivity to human samples\n87095-1-RR targets GPR37 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe orphan G protein-coupled receptor GPR37, also known as PAELR (parkin-associated endothelin receptor-like receptor) or ETBR-LP-1 (endothelin B receptor-like protein 1), is a 613 aa, multi-pass membrane protein predominantly expressed in the brain. It is a substrate of parkin (PARK2). When overexpressed in cells, GPR37 tends to become insoluble, unfolded, and ubiquitinated in vivo. Accumulation of the unfolded protein may lead to dopaminergic neuronal death in juvenile Parkinson disease (JPD). This antibody recognizes endogenous GPR37, which migrates as an approximately 50-55 kDa band in SDS-PAGE (PMID:17519329).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg5426 Product name: Recombinant human GPR37 protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 27-265 aa of NM_005302.5 Sequence: ALGVAPASRNETCLGESCAPTVIQRRGRDAWGPGNSARDVLRARAPREEQGAAFLAGPSWDLPAAPGRDPAAGRGAEASAAGPPGPPTRPPGPWRWKGARGQEPSETLGRGNPTALQLFLQISEEEEKGPRGAGISGRSQEQSVKTVPGASDLFYWPRRAGKLQGSHHKPLSKTANGLAGHEGWTIALPGRALAQNGSLGEGIHEPGGPRRGNSTNRRVRLKNPFYPLTQESYGAYAVM Predict reactive species\nFull Name: G protein-coupled receptor 37 (endothelin receptor type B-like)\nCalculated Molecular Weight: 67 kDa\nObserved Molecular Weight: 67 kDa\nGenBank Accession Number: NM_005302.5\nGene Symbol: GPR37\nGene ID (NCBI): 2861\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O15354\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888757919913,"sku":"87095-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-87095-1-rr","provider":"Iright","version":"1.0","type":"link"}