{"product_id":"proteintech-87115-2-rr","title":"Proteintech, 87115-2-RR, STAC2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe STAC2 (87115-2-RR) by Proteintech is a Recombinant antibody targeting STAC2 in WB, ELISA applications with reactivity to human samples\n87115-2-RR targets STAC2 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SH-SY5Y cells, K-562 cells,  THP-1 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSTAC2 (Src homology 3 and cysteine-rich domain 2) contains an SH3 domain and a zinc finger domain. STAC2 has been shown to negatively regulate osteoclast formation by targeting the RANK signaling complex. This mechanism involves inhibiting the formation of complexes containing Gab2 and PLCγ2, thereby suppressing NF-κB and MAPK signaling pathways.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag16601 Product name: Recombinant human STAC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 65-154 aa of BC109231 Sequence: TLRYGTSLALMNRSSFSSTSESPTRSLSERDELTEDGEGSIRSSEEGPGDSASPVFTAPAESEGPGPEEKSPGQQLPKATLRKDVGPMYS Predict reactive species\nFull Name: SH3 and cysteine rich domain 2\nCalculated Molecular Weight: 411 aa, 45 kDa\nObserved Molecular Weight: 55-57 kDa\nGenBank Accession Number: BC109231\nGene Symbol: STAC2\nGene ID (NCBI): 342667\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q6ZMT1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888827486377,"sku":"87115-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-87115-2-rr","provider":"Iright","version":"1.0","type":"link"}