{"product_id":"proteintech-87123-1-rr","title":"Proteintech, 87123-1-RR, GIPR Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe GIPR (87123-1-RR) by Proteintech is a Recombinant antibody targeting GIPR in WB, ELISA applications with reactivity to human, rat samples\n87123-1-RR targets GIPR in WB, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HT-1080 cells, rat heart tissue,  Recombinant protein\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGIPR, or Gastric Inhibitory Polypeptide Receptor, plays a crucial role in glucose metabolism and insulin secretion. It is a G protein-coupled receptor (GPCR). It belongs to the B1 class of this receptor family, which is involved in various physiological processes including fat generation, pancreatic beta-cell proliferation, and insulin release.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg6484 Product name: Recombinant human GIPR protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 22-138 aa of NM_000164.3 Sequence: RAETGSKGQTAGELYQRWERYRRECQETLAAAEPPSGLACNGSFDMYVCWDYAAPNATARASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCENPEKNEAFLDQRLILERLQ Predict reactive species\nFull Name: gastric inhibitory polypeptide receptor\nCalculated Molecular Weight: 53 kDa\nObserved Molecular Weight: 53 kDa\nGenBank Accession Number: NM_000164.3\nGene Symbol: GIPR\nGene ID (NCBI): 2696\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P48546\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888755626153,"sku":"87123-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-87123-1-rr","provider":"Iright","version":"1.0","type":"link"}