{"product_id":"proteintech-87151-1-rr","title":"Proteintech, 87151-1-RR, CHMP2B Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CHMP2B (87151-1-RR) by Proteintech is a Recombinant antibody targeting CHMP2B in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n87151-1-RR targets CHMP2B in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, A549 cells,  HEK-293T cells,  MCF-7 cells,  NIH\/3T3 cells,  mouse brain tissue,  rat brain tissue\nPositive IF\/ICC detected in: NIH\/3T3 cells, HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCHMP2B, chromatin-modifying protein 2b, also named CHMP2.5, VPS2B, and VPS2-2, belongs to the chromatin-modifying protein \/ charged multivesicular body protein (CHMP) family. It is a component of the endosomal sorting complex required for transport III (ESCRT-III), which is involved in endosomal and autophagic trafficking of proteins to lysosomes for degradation. Mutations of CHMP2B lead to C-terminal truncation or are replaced with mis-splicing C-termini and cause frontotemporal lobar degeneration (FTLD). In CHMP2B mutation patients, p62- and ubiquitin-positive, but TDP-43 and FUS-negative neural inclusions are formed, which may be caused by impaired lysosomal degradation through the autophagy and endosome-lysosome pathways.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag3222 Product name: Recombinant human CHMP2B protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 1-213 aa of BC001553 Sequence: MASLFKKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACKVLAKQLVHLRKQKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEEMINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARSLPSASTSKATISDEEIERQLKALGVD Predict reactive species\nFull Name: chromatin modifying protein 2B\nCalculated Molecular Weight: 24 kDa\nObserved Molecular Weight: 30-32 kDa\nGenBank Accession Number: BC001553\nGene Symbol: CHMP2B\nGene ID (NCBI): 25978\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9UQN3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888726003881,"sku":"87151-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-87151-1-rr","provider":"Iright","version":"1.0","type":"link"}