{"product_id":"proteintech-87166-1-rr","title":"Proteintech, 87166-1-RR, HERC5 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe HERC5 (87166-1-RR) by Proteintech is a Recombinant antibody targeting HERC5 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n87166-1-RR targets HERC5 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, A549 cells,  Jurkat cells,  U-251 cells\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHERC5 (HECT and RLD domain-containing E3 ubiquitin ligase 5) is constitutively expressed at low or undetectable levels in most normal adult tissues and in a subset of cancer cell lines.  It is an evolutionarily ancient restriction factor that inhibits the replication of diverse viruses.    By virtue of its C-terminal HECT domain, HERC5 is the main cellular E3 ligase for conjugating ISG15 to substrates and localizes to polyribosomes to modify newly translated viral proteins, thereby disrupting key aspects of viral particle production. E3 ligase-independent antiviral activity has also been demonstrated towards HIV-1, where it inhibits the nuclear export of incompletely-spliced viral RNAs by a mechanism requiring its N-terminal RCC1-like domain (RLD). (PMID: 34572049)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag33511 Product name: Recombinant human HERC5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 160-342 aa of BC140716 Sequence: FAWGQNLHGQLGVGRKFPSTTTPQIVEHLAGVPLAQISAGEAHSMALSMSGNIYSWGKNECGQLGLGHTESKDDPSLIEGLDNQKVEFVACGGSHSALLTQDGLLFTFGAGKHGQLGHNSTQNELRPCLVAELVGYRVTQIACGRWHTLAYVSDLGKVFSFGSGKDGQLGNGGTRDQLMPLPV Predict reactive species\nFull Name: hect domain and RLD 5\nCalculated Molecular Weight: 1024 aa, 117 kDa\nObserved Molecular Weight: 117 kDa\nGenBank Accession Number: BC140716\nGene Symbol: HERC5\nGene ID (NCBI): 51191\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9UII4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888761032873,"sku":"87166-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-87166-1-rr","provider":"Iright","version":"1.0","type":"link"}