{"product_id":"proteintech-87170-3-rr","title":"Proteintech, 87170-3-RR, BLNK Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe BLNK (87170-3-RR) by Proteintech is a Recombinant antibody targeting BLNK in WB, ELISA applications with reactivity to human samples\n87170-3-RR targets BLNK in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Raji cells, Sp2\/0 cells,  Ramos cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBLNK is a cytoplasmic linker or adaptor protein that plays a critical role in B cell development. This protein bridges B cell receptor-associated kinase activation with downstream signaling pathways, thereby affecting various biological functions. The phosphorylation of five tyrosine residues is necessary for this protein to nucleate distinct signaling effectors following B cell receptor activation. Mutations in this gene cause hypoglobulinemia and absent B cells, a disease in which the pro- to pre-B-cell transition is developmentally blocked. Deficiency in this protein has also been shown in some cases of pre-B acute lymphoblastic leukemia.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg6610 Product name: Recombinant Human BLNK protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 330-456 aa of NM_013314.4 Sequence: SNSTISEQEAGVLCKPWYAGACDRKSAEEALHRSNKDGSFLIRKSSGHDSKQPYTLVVFFNKRVYNIPVRFIEATKQYALGRKKNGEEYFGSVAEIIRNHQHSPLVLIDSQNNTKDSTRLKYAVKVS Predict reactive species\nFull Name: B-cell linker\nCalculated Molecular Weight: 50 kDa\nObserved Molecular Weight: 68-70 kDa\nGenBank Accession Number: NM_013314.4\nGene Symbol: BLNK\nGene ID (NCBI): 29760\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q8WV28-1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888591294633,"sku":"87170-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-87170-3-rr","provider":"Iright","version":"1.0","type":"link"}