{"product_id":"proteintech-87199-1-rr","title":"Proteintech, 87199-1-RR, UQCRQ Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe UQCRQ (87199-1-RR) by Proteintech is a Recombinant antibody targeting UQCRQ in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n87199-1-RR targets UQCRQ in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, mouse skeletal muscle tissue,  HepG2 cells,  Jurkat cells,  human skeletal muscle tissue,  rat skeletal muscle tissue,  mouse liver tissue\nPositive IHC detected in: rat liver tissue, mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUQCRQ(Cytochrome b-c1 complex subunit 8) belongs to the UQCRQ\/QCR8 family. UQCRQ is a ubiquinone-binding protein localized to the cytochrome bc1 region of the mitochondrial respiratory chain.  The deduced 110-amino acid protein has a relatively hydrophobic and basic N-terminal region, an aspartic acid-rich middle region, and a glutamic acid- and lysine-rich C-terminal region.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag6907 Product name: Recombinant human UQCRQ protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-82 aa of BC001390 Sequence: MGREFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIPNVLRRIRESFFRVVPQFVVFYLIYTWGTEEFERSKRKNPAAYENDK Predict reactive species\nFull Name: ubiquinol-cytochrome c reductase, complex III subunit VII, 9.5kDa\nCalculated Molecular Weight: 10 kDa\nObserved Molecular Weight: 10 kDa\nGenBank Accession Number: BC001390\nGene Symbol: UQCRQ\nGene ID (NCBI): 27089\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O14949\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888839676073,"sku":"87199-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-87199-1-rr","provider":"Iright","version":"1.0","type":"link"}