{"product_id":"proteintech-87230-1-rr","title":"Proteintech, 87230-1-RR, IL-11 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe IL-11 (87230-1-RR) by Proteintech is a Recombinant antibody targeting IL-11 in WB, ELISA applications with reactivity to mouse, rat samples\n87230-1-RR targets IL-11 in WB, ELISA applications and shows reactivity with mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat plasma, rat serum\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIL-11 is a member of the interleukin family of cytokines. It was discovered in the late 20th century as researchers were exploring various cytokines involved in immune responses and cell growth regulation. IL-11 has significant effects on hematopoietic cells. It can stimulate the proliferation and differentiation of megakaryocytes, which are the precursors of platelets. This action helps in the regulation of platelet production.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg2935 Product name: recombinant mouse Il11 protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 22-199 aa of NM_008350.4 Sequence: PGPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHSLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYLRHVQWLRRAGGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPVIPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRL Predict reactive species\nFull Name: interleukin 11\nCalculated Molecular Weight: 22 kDa\nObserved Molecular Weight: 25 kDa\nGenBank Accession Number: NM_008350.4\nGene Symbol: Il11\nGene ID (NCBI): 16156\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P47873\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888643395753,"sku":"87230-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-87230-1-rr","provider":"Iright","version":"1.0","type":"link"}