{"product_id":"proteintech-87277-1-rr","title":"Proteintech, 87277-1-RR, HTR2B Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe HTR2B (87277-1-RR) by Proteintech is a Recombinant antibody targeting HTR2B in WB, ELISA applications with reactivity to human samples\n87277-1-RR targets HTR2B in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  HT-29 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe serotonin (5-HT) gene has been implicated in the development of personality traits or temperament predisposition. HTR2B(serotonin receptor 2B) has been shown that 3,4-methylene-dioxymethamphetamine, commonly referred to as the drug ecstasy, selectively binds and activates 5-HT2B receptors to induce serotonin release in mouse raphe nuclei, which leads to dopamine release in the nucleus accumbens and ventral tegmentum (PMID:23774082). Moreover, One of the most reliable predictive markers of UM (Uveal melanoma) at risk of evolving toward the formation of liver lesions is an abnormally elevated level of expression of the transcript encoding the HTR2B (PMID:31002821).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag24007 Product name: Recombinant human HTR2B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-56 aa of BC063123 Sequence: MALSYRVSELQSTIPEHILQSTFVHVISSNWSGLQTESIPEEMKQIVEEQGNKLHW Predict reactive species\nFull Name: 5-hydroxytryptamine (serotonin) receptor 2B\nCalculated Molecular Weight: 54 kDa\nObserved Molecular Weight: 57 kDa\nGenBank Accession Number: BC063123\nGene Symbol: HTR2B\nGene ID (NCBI): 3357\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P41595\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888764276905,"sku":"87277-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-87277-1-rr","provider":"Iright","version":"1.0","type":"link"}