{"product_id":"proteintech-87348-2-rr","title":"Proteintech, 87348-2-RR, IL-18 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe IL-18 (87348-2-RR) by Proteintech is a Recombinant antibody targeting IL-18 in WB, IP, ELISA applications with reactivity to mouse, rat samples\n87348-2-RR targets IL-18 in WB, IP, ELISA applications and shows reactivity with mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse spleen tissue, rat spleen tissue\nPositive IP detected in: mouse spleen tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIL-18 is a proinflammatory cytokine involved in the development of Th1 cells and in immune response. It can stimulate the NK cells and certain T cells to release IFN gamma, which plays an important role in activating the macrophages or other cells. IL-18 has been demonstrated to have the potential to enhance Fas ligand-mediated cytotoxicity, which is increased in PE and regulates placental apoptosis. IL-18 is synthesized as a 22 kDa precursor and then cleaved into a biologically active 18 kDa form. This antibody recognizes both the pre-IL18 and mature IL18 theoretically.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg4455 Product name: recombinant mouse IL-18 protein Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 1-192 aa of NM_008360.1 Sequence: MAAMSEDSCVNFKEMMFIDNTLYFIPEENGDLESDNFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS Predict reactive species\nFull Name: interleukin 18\nCalculated Molecular Weight: 22 kDa\nObserved Molecular Weight: 22 kDa\nGenBank Accession Number: NM_008360.1\nGene Symbol: Il18\nGene ID (NCBI): 16173\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P70380\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888643788969,"sku":"87348-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-87348-2-rr","provider":"Iright","version":"1.0","type":"link"}