{"product_id":"proteintech-87374-1-rr","title":"Proteintech, 87374-1-RR, VHL Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe VHL (87374-1-RR) by Proteintech is a Recombinant antibody targeting VHL in WB, ELISA applications with reactivity to human samples\n87374-1-RR targets VHL in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, Daudi cells,  Raji cells,  Ramos cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nVHL (von Hippel-Lindau tumor suppressor) gene was identified as the tumor suppressor gene whose germ line mutations are associated with the inherited von Hippel-Lindau cancer syndrome (PMID: 8603073, 10722748). VHL patients develop a wide variety of tumors including retinal angioma, central nervous system hemangioblastoma, pheochromocytoma, and renal clear cell carcinoma (PMID: 10722748). VHL localizes predominantly to the cytoplasmic compartment but engages in a dynamic nuclear-cytoplasmic shuttle (PMID: 8700833, 9891082, 12101228). VHL has isoforms with the molecular mass of 18-24 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg6405 Product name: Recombinant human VHL protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 1-213 aa of NM_000551.4 Sequence: MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD Predict reactive species\nFull Name: von Hippel-Lindau tumor suppressor\nCalculated Molecular Weight: 24 kDa\nObserved Molecular Weight: 18-24 kDa\nGenBank Accession Number: NM_000551.4\nGene Symbol: VHL\nGene ID (NCBI): 7428\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P40337\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888841314473,"sku":"87374-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-87374-1-rr","provider":"Iright","version":"1.0","type":"link"}