{"product_id":"proteintech-87402-1-rr","title":"Proteintech, 87402-1-RR, Tnfrsf14 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe Tnfrsf14 (87402-1-RR) by Proteintech is a Recombinant antibody targeting Tnfrsf14 in WB, ELISA applications with reactivity to mouse samples\n87402-1-RR targets Tnfrsf14 in WB, ELISA applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse thymus tissue, mouse spleen tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe mammalian tumor necrosis factor receptor (TNFR) family consists of 10 cell-surface proteins that regulate development and homeostasis of the immune system. Member 14 of TNFR (TNFRSF14, also named as TR2, ATAR, HVEA, HVEM, LIGHTR) was also identified as a mediator of herpesvirus entry into mammalian cells. The cytoplasmic region of TNFRSF14 bound to several members of the TNFR-associated factor (TRAF) family, namely TRAF1, TRAF2, TRAF3, and TRAF5.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg3145 Product name: Recombinant mouse Tnfrsf14 protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 39-207 aa of NM_178931.2 Sequence: QPSCRQEEFLVGDECCPMCNPGYHVKQVCSEHTGTVCAPCPPQTYTAHANGLSKCLPCGVCDPDMGLLTWQECSSWKDTVCRCIPGYFCENQDGSHCSTCLQHTTCPPGQRVEKRGTHDQDTVCADCLTGTFSLGGTQEECLPWTNCSAFQQEVRRGTNSTDTTCSSQV Predict reactive species\nFull Name: tumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator)\nCalculated Molecular Weight: 30 kDa\nObserved Molecular Weight: 30-40 kDa\nGenBank Accession Number: NM_178931.2\nGene Symbol: Tnfrsf14\nGene ID (NCBI): 230979\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q80WM9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888670593193,"sku":"87402-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-87402-1-rr","provider":"Iright","version":"1.0","type":"link"}