{"product_id":"proteintech-87403-1-rr","title":"Proteintech, 87403-1-RR, Ly-6A\/E (Sca-1) Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe Ly-6A\/E (Sca-1) (87403-1-RR) by Proteintech is a Recombinant antibody targeting Ly-6A\/E (Sca-1) in WB, ELISA applications with reactivity to mouse samples\n87403-1-RR targets Ly-6A\/E (Sca-1) in WB, ELISA applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: C2C12 cells, mouse bone marrow tissue,  mouse kidney tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe lymphocyte antigen 6 (Ly-6) supergene family encodes proteins of 12-14 kda in molecular mass that are either secreted or anchored to the plasma membrane through a glycosyl-phosphatidylinisotol (GPI) lipid anchor at the carboxy-terminus. Mouse Ly-6A, also known as Sca-1 (Stem cell antigen 1), is a GPI-anchored membrane protein and the prototypic member of the lymphocyte antigen 6 (Ly-6) supergene family. These proteins were first described as allo-antigens expressed on activated murine lymphocytes (PMID: 28660664). Ly-6A\/E (Sca-1) is expressed in activated lymphocytes, hematopoietic stem cells and stem cells of a variety of tissues in mice (PMID: 24586463).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg4270 Product name: recombinant mouse Ly6a protein Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 27-112 aa of NM_001271416.1 Sequence: LECYQCYGVPFETSCPSITCPYPDGVCVTQEAAVIVDSQTRKVKNNLCLPICPPNIESMEILGTKVNVKTSCCQEDLCNVAVPNGG Predict reactive species\nFull Name: lymphocyte antigen 6 complex, locus A\nCalculated Molecular Weight: 14 kDa\nObserved Molecular Weight: 14-18 kDa\nGenBank Accession Number: NM_001271416.1\nGene Symbol: Ly6a\nGene ID (NCBI): 110454\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P05533\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888778629289,"sku":"87403-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-87403-1-rr","provider":"Iright","version":"1.0","type":"link"}