{"product_id":"proteintech-87415-1-rr","title":"Proteintech, 87415-1-RR, ANKFY1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe ANKFY1 (87415-1-RR) by Proteintech is a Recombinant antibody targeting ANKFY1 in WB, ELISA applications with reactivity to human samples\n87415-1-RR targets ANKFY1 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: U2OS cells, 5637 cells,  HUVEC cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nANKFY1 also named as ANKHZN or Ankyrin repeats hooked to a zinc finger motif is a 1169 amino acid protein, which is a cytoplasm protein on embryonic stem cells. ANKFY1 protein is ubiquitously expressed in a spatiotemporal specific manner and is located on endosomes. ANKFY1 is expressed at various levels in human tissues and also present in both membrane and soluble fractions obtained on subcellular fractionation. ANKFY1 is a single copy gene consisting of predicted 25 exons in the human genome, and has been mapped to human chromosome 17p13.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag19267 Product name: Recombinant human ANKFY1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 817-1170 aa of BC152991 Sequence: GVIIQLLVSHPDIHLNVRDRQGLTPFACAMTFKNNKSAEAILKRESGAAEQVDNKGRNFLHVAVQNSDIESVLFLISVHANVNSRVQDASKLTPLHLAVQAGSEIIVRNLLLAGAKVNELTKHRQTALHLAAQQDLPTICSVLLENGVDFAAVDENGNNALHLAVMHGRLNNIRVLLTECTVDAEAFNLRGQSPLHILGQYGKENAAAIFDLFLECMPGYPLDKPDADGSTVLLLAYMKGNANLCRAIVRSGARLGVNNNQGVNIFNYQVATKQLLFRLLDMLSKEPPWCDGSYCYECTARFGVTTRKHHCRHCGRLLCHKCSTKEIPIIKFDLNKPVRVCNICFDVLTLGGVS Predict reactive species\nFull Name: ankyrin repeat and FYVE domain containing 1\nCalculated Molecular Weight: 1169 aa, 129 kDa\nObserved Molecular Weight: 132 kDa\nGenBank Accession Number: BC152991\nGene Symbol: ANKFY1\nGene ID (NCBI): 51479\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9P2R3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888692875433,"sku":"87415-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-87415-1-rr","provider":"Iright","version":"1.0","type":"link"}