{"product_id":"proteintech-87439-1-rr","title":"Proteintech, 87439-1-RR, CCL4\/MIP-1 beta Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CCL4\/MIP-1 beta (87439-1-RR) by Proteintech is a Recombinant antibody targeting CCL4\/MIP-1 beta in WB, ELISA applications with reactivity to mouse, rat samples\n87439-1-RR targets CCL4\/MIP-1 beta in WB, ELISA applications and shows reactivity with mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PMA, LPS and Brefeldin A treated RAW 264.7 cells\nPositive IF\/ICC detected in: PMA, LPS and Brefeldin A treated NR8383 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCCL4 (C-C motif chemokine ligand 4), also known as macrophage inflammatory protein-1β (MIP-1β), is a pivotal chemokine that governs immune cell migration and activation. By binding primarily to its receptor CCR5, it directs the recruitment of monocytes, dendritic cells, natural killer (NK) cells, and T lymphocytes to sites of inflammation and infection. CCL4 plays a crucial role in antiviral defense, antitumor immunity, and inflammatory responses. However, dysregulated CCL4 signaling is implicated in the pathogenesis of chronic inflammatory diseases, autoimmune disorders, and cancer progression. Notably, due to its shared use of the CCR5 receptor with HIV-1, CCL4 also participates in HIV pathogenesis. This dual role as a mediator of both protective immunity and pathology positions CCL4 as a significant biomarker and a promising therapeutic target in immunology and medicine.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg3200 Product name: recombinant rat CCL4\/MIP-1 beta protein Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 24-92 aa of NM_053858.1 Sequence: APIGSDPPTSCCFSYTSRKIHRNFVMDYYETSSLCSQPAVVFLTKKGRQICADPSEPWVNEYVNDLELN Predict reactive species\nFull Name: chemokine (C-C motif) ligand 4\nCalculated Molecular Weight: 10 kDa\nObserved Molecular Weight: 10 kDa\nGenBank Accession Number: NM_053858.1\nGene Symbol: Ccl4\nGene ID (NCBI): 116637\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P50230\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888599519401,"sku":"87439-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-87439-1-rr","provider":"Iright","version":"1.0","type":"link"}