{"product_id":"proteintech-87496-1-rr","title":"Proteintech, 87496-1-RR, PPIL2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe PPIL2 (87496-1-RR) by Proteintech is a Recombinant antibody targeting PPIL2 in WB, ELISA applications with reactivity to human, mouse, rat samples\n87496-1-RR targets PPIL2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse kidney tissue, HEK-293 cells,  rat kidney tissue,  mouse thymus tissue,  mouse pancreas tissue,  rat testis tissue,  human kidney tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPeptidylprolyl isomerase (cyclophilin)-like 2 (PPIL2), also known as Cyclophilin-like protein Cyp-60, is a U-box-type E3 ubiquitin ligase belonging to the cyclophilin family. PPIL2 is also a target of the JAK2\/STAT5 pathway and upregulated in patients with MPNs (PMID: 36092721, 25992900). PPIL2 is a large ~60 kDa (520 amino acids) protein that has a central cyclophilin-like domain and also has an N-terminal U-box domain that exhibits E3 ligase activity. Western detected PPIL2 at an apparent molecular mass of 60~70 kDa (PMID: 40338661, 29352246).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg6018 Product name: Recombinant human PPIL2 protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 280-457 aa of NM_148176.2 Sequence: GYVRLHTNKGDLNLELHCDLTPKTCENFIRLCKKHYYDGTIFHRSIRNFVIQGGDPTGTGTGGESYWGKPFKDEFRPNLSHTGRGILSMANSGPNSNRSQFFITFRSCAYLDKKHTIFGRVVGGFDVLTAMENVESDPKTDRPKEEIRIDATTVFVDPYEEADAQIAQERKTQLKVAP Predict reactive species\nFull Name: peptidylprolyl isomerase (cyclophilin)-like 2\nCalculated Molecular Weight: 59 kDa\nGenBank Accession Number: NM_148176.2\nGene Symbol: PPIL2\nGene ID (NCBI): 23759\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q13356-2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888809529513,"sku":"87496-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-87496-1-rr","provider":"Iright","version":"1.0","type":"link"}