{"product_id":"proteintech-87516-1-rr","title":"Proteintech, 87516-1-RR, TUBG2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe TUBG2 (87516-1-RR) by Proteintech is a Recombinant antibody targeting TUBG2 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat, canine samples\n87516-1-RR targets TUBG2 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat, canine samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, T-47D cells,  SK-BR-3 cells,  MDCK cells,  COS-7 cells,  mouse cerebellum tissue,  rat cerebellum tissue\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:250-1:1000\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, canine\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag27728 Product name: Recombinant human TUBG2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 358-451 aa of BC051890 Sequence: VALSRKSPYLPSAHRVSGLMMANHTSISSLFESSCQQFDKLRKRDAFLEQFRKEDMFKDNFDEMDRSREVVQELIDEYHAATQPDYISWGTQEQ Predict reactive species\nFull Name: tubulin, gamma 2\nCalculated Molecular Weight: 451 aa, 51 kDa\nObserved Molecular Weight: 51 kDa\nGenBank Accession Number: BC051890\nGene Symbol: TUBG2\nGene ID (NCBI): 27175\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9NRH3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888837972137,"sku":"87516-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-87516-1-rr","provider":"Iright","version":"1.0","type":"link"}