{"product_id":"proteintech-87528-1-rr","title":"Proteintech, 87528-1-RR, NRAC Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe NRAC (87528-1-RR) by Proteintech is a Recombinant antibody targeting NRAC in WB, ELISA applications with reactivity to human samples\n87528-1-RR targets NRAC in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human heart tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNRAC (Nutritionally Regulated Adipose and Cardiac enriched protein, with the human homologous gene designated as C14ORF180) is a recently identified adipocyte-specific double-pass transmembrane protein. Both its N- and C-termini are located intracellularly, containing only a short extracellular loop and no known enzymatic domains. Its expression is significantly induced during the differentiation of white and brown adipocytes and is regulated by nutritional status: fasting and obesity both downregulate its mRNA levels, suggesting its role as a \"fat sensor\" in energy homeostasis. Mechanistically, NRAC forms a trimeric complex via its first transmembrane domain with the fatty acid transporter core protein CD36 and the membrane microdomain protein caveolin-1. When extracellular fatty acid concentrations increase, NRAC undergoes ubiquitination and internalization, causing CD36 to dissociate from caveolin-1 and switch to clathrin-mediated endocytosis. This process enhances fatty acid uptake, leading to adipocyte hypertrophy and increased overall adipose mass.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg6025 Product name: Recombinant human NRAC protein (C-rFc) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 1-100 aa of NM_001008404.2 Sequence: MRTAAGAVSPDSRPETRRQTRKNEEAAWGPRVCRAEREDNRKCPPSILKRSRPEHHRPEAKPQRTSRRVWFREPPAVTVHYIADKNATATVRVPGRPRPH Predict reactive species\nFull Name: chromosome 14 open reading frame 180\nCalculated Molecular Weight: 18 kDa\nObserved Molecular Weight: 18 kDa\nGenBank Accession Number: NM_001008404.2\nGene Symbol: C14orf180\nGene ID (NCBI): 400258\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q8N912\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888792785065,"sku":"87528-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-87528-1-rr","provider":"Iright","version":"1.0","type":"link"}