{"product_id":"proteintech-87552-1-rr","title":"Proteintech, 87552-1-RR, MMP7 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe MMP7 (87552-1-RR) by Proteintech is a Recombinant antibody targeting MMP7 in WB, ELISA applications with reactivity to human samples\n87552-1-RR targets MMP7 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, SKOV-3 cells,  HT-29 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMatrix metalloproteinase-7 (MMP-7)\/ matrilysin is a member of the MMP family, but is structurally different from the other MMPs by virtue of the absence of a conserved COOH-terminal protein domain. MMPs are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and cancer metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. MMP-7 degrades proteoglycans, fibronectin, elastin and casein, and is involved in wound healing, tumor progression, pulmonary fibrosis, and development of choroidal neovascularization in age-related macular degeneration. The expression of MMP-7 is increased in most tumors.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag0550 Product name: Recombinant human MMP7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC003635 Sequence: MRLTVLCAVCLLPGSLALPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLKEMQKFFGLPITGMLNSHVIEIMQKPRCGVPDVAEYSLFPN Predict reactive species\nFull Name: matrix metallopeptidase 7 (matrilysin, uterine)\nCalculated Molecular Weight: 29 kDa\nObserved Molecular Weight: 27-30 kDa\nGenBank Accession Number: BC003635\nGene Symbol: MMP7\nGene ID (NCBI): 4316\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P09237\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888783773865,"sku":"87552-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-87552-1-rr","provider":"Iright","version":"1.0","type":"link"}