{"product_id":"proteintech-87576-1-rr","title":"Proteintech, 87576-1-RR, NAT8L Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe NAT8L (87576-1-RR) by Proteintech is a Recombinant antibody targeting NAT8L in WB, ELISA applications with reactivity to human, mouse, rat samples\n87576-1-RR targets NAT8L in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SH-SY5Y cells, U-87 MG cells,  HepG2 cells,  HUVEC cells,  mouse brain tissue,  rat brain tissue,  fetal human brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNAT8L (N-acetyltransferase 8-like) catalyzes the formation of N-acetyl aspartate (NAA) from acetyl-CoA and aspartate. In the brain, NAA delivers the acetate moiety to synthesize acetyl-CoA, which is further used for fatty acid generation (PMID: 24155240). NAT8L modulation may impinge on the metabolic reprogramming of cancer cells (PMID: 36580805). The calculated MW of NAT8L is around 33 kDa, and the observed MW is around 45 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag34067 Product name: Recombinant human NAT8L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-134 aa of BC103748 Sequence: MADIEQYYMKPPGSCFWVAVLDGNVVGIVAARAHEEDNTVELLRMSVDSRFRGKGIAKALGRKVLEFAVVHNYSAVVLGTTAVKVAAHKLYESLGFRHMGASDHYVLPGMTLSLAERLFFQVRYHRYRLQLREE Predict reactive species\nFull Name: N-acetyltransferase 8-like (GCN5-related, putative)\nCalculated Molecular Weight: 134 aa, 15 kDa\nObserved Molecular Weight: 45 kDa\nGenBank Accession Number: BC103748\nGene Symbol: NAT8L\nGene ID (NCBI): 339983\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q8N9F0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888788492457,"sku":"87576-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-87576-1-rr","provider":"Iright","version":"1.0","type":"link"}