{"product_id":"proteintech-87585-1-rr","title":"Proteintech, 87585-1-RR, CHRNA9 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CHRNA9 (87585-1-RR) by Proteintech is a Recombinant antibody targeting CHRNA9 in WB, ELISA applications with reactivity to human, mouse, rat samples\n87585-1-RR targets CHRNA9 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, Jurkat cells,  mouse skin tissue,  rat skin tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCHRNA9 (nicotinic α9 subunit of cholinergic receptor) gene is located in zone 4 (4p14) of short arm 1 of human chromosome 4, encoding a ligand-gated divalent cation channel protein, belonging to the nicotinic acetylcholine receptor (nAChR) superfamily. This subunit can be combined with CHRNA10 subunit to form a heteropentamer or a homopentamer, which is mainly distributed in cochlear outer hair cells, dorsal root ganglion, keratinocytes and immune cells.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag23272 Product name: Recombinant human CHRNA9 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 324-479 aa of BC113549 Sequence: HFCGAEARPVPHWARVVILKYMSRVLFVYDVGESCLSPHHSRERDHLTKVYSKLPESNLKAARNKDLSRKKDMNKRLKNDLGCQGKNPQEAESYCAQYKVLTRNIEYIAKCLKDHKATSSKGSEWKKVAKVIDRFFMWIFFIMVFVMTILIIARAD Predict reactive species\nFull Name: cholinergic receptor, nicotinic, alpha 9\nCalculated Molecular Weight: 479 aa, 55 kDa\nObserved Molecular Weight: 50-55 kDa\nGenBank Accession Number: BC113549\nGene Symbol: CHRNA9\nGene ID (NCBI): 55584\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9UGM1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888726167721,"sku":"87585-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-87585-1-rr","provider":"Iright","version":"1.0","type":"link"}