{"product_id":"proteintech-87640-1-rr","title":"Proteintech, 87640-1-RR, CD133 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CD133 (87640-1-RR) by Proteintech is a Recombinant antibody targeting CD133 in WB, ELISA applications with reactivity to human samples\n87640-1-RR targets CD133 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Caco-2 cells, HCT 116 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD133, also known as PROM1 (prominin-1) or AC133, belongs to the prominin family. CD133 is a transmembrane glycoprotein with an NH2-terminal extracellular domain, five transmembrane loops and a cytoplasmic tail. The expression of CD133 has been reported in hematopoietic stem cells, endothelial progenitor cells, neuronal and glial stem cells, suggesting the potential role of CD133 as a cell surface marker of adult stem cells. CD133 has also been reported as a marker of cancer stem cells in various human tumors. CD133 is a highly glycosylated protein with an apparent molecular weight of 115-120 kDa. After the treatment of the lysates with glycosidase, CD133 shifted to a protein with an apparent molecular weight of 80-90 kDa (PMID: 23150174; 20068153).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg3738 Product name: Recombinant human CD133 protein Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 179-433 aa of NM_006017 Sequence: ANHQVRTRIKRSRKLADSNFKDLRTLLNETPEQIKYILAQYNTTKDKAFTDLNSINSVLGGGILDRLRPNIIPVLDEIKSMATAIKETKEALENMNSTLKSLHQQSTQLSSSLTSVKTSLRSSLNDPLCLVHPSSETCNSIRLSLSQLNSNPELRQLPPVDAELDNVNNVLRTDLDGLVQQGYQSLNDIPDRVQRQTTTVVAGIKRVLNSIGSDIDNVTQRLPIQDILSAFSVYVNNTESYIHRNLPTLEEYDSY Predict reactive species\nFull Name: prominin 1\nCalculated Molecular Weight: 97kd\nObserved Molecular Weight: 120 kDa\nGenBank Accession Number: NM_006017\nGene Symbol: CD133\nGene ID (NCBI): 8842\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O43490\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888718336169,"sku":"87640-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-87640-1-rr","provider":"Iright","version":"1.0","type":"link"}