{"product_id":"proteintech-98015-1-rr","title":"Proteintech, 98015-1-RR, Anti-Mouse IL-21 Rabbit Recombinant Antibody","description":"Size: 100ug\nThe IL-21 (98015-1-RR) by Proteintech is a Recombinant antibody targeting IL-21 in FC (Intra) applications with reactivity to mouse samples\n98015-1-RR targets IL-21 in FC (Intra) applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC (Intra) detected in: PMA, Ionomycin and Brefeldin A treated mouse splenocytes\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in 100 μl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nInterleukin 21 (IL-21) is a cytokine produced predominantly by cluster of differentiation 4 (CD4+) T-cells and natural killer T-cells. IL-21 is preliminarily expressed in activated cluster of differentiation 4 (CD4+) T-cells and natural killer (NK) T-cells. IL-21 receptor (IL-21R) is a class I cytokine receptor, which requires dimerization with the indispensable common gamma chain (γc) subunit to bind IL-21. IL-21 plays a role in both the innate and adaptive immune responses by inducing the differentiation, proliferation and activity of multiple target cells including macrophages, natural killer cells, B cells and cytotoxic T cells. IL-21 mediates apoptosis in B-CLL cells through up-regulation of the BIM (BH3 family member) and enhances both direct and antibody-dependent cellular cytotoxicity in these cells.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg0234 Product name: recombinant mouse IL21 protein Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 25-146 aa of NM_001291041 Sequence: PDRLLIRLRHLIDIVEQLKIYENDLDPELLSAPQDVKGHCEHAAFACFQKAKLKPSNPGNNKTFIIDLVAQLRRRLPARRGGKKQKHIAKCPSCDSYEKRTPKEFLERLKWLLQKMIHQHLS Predict reactive species\nFull Name: interleukin 21\nCalculated Molecular Weight: 17 aa\nGenBank Accession Number: NM_001291041\nGene Symbol: IL-21\nGene ID (NCBI): 60505\nRRID: AB_3672158\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q9ES17\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2-8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888574320809,"sku":"98015-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-98015-1-rr","provider":"Iright","version":"1.0","type":"link"}