{"product_id":"proteintech-98021-1-rr","title":"Proteintech, 98021-1-RR, Anti-Mouse TNFR2\/CD120b Rabbit Recombinant Antibody","description":"Size: 100ug\nThe TNFR2\/CD120b (98021-1-RR) by Proteintech is a Recombinant antibody targeting TNFR2\/CD120b in FC applications with reactivity to mouse samples\n98021-1-RR targets TNFR2\/CD120b in FC applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: mouse splenocytes\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 0.25 ug per 10^6 cells in 100 μl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTumor necrosis factor-alpha (TNFA\/TNFSF2) is a multifunctional cytokine that plays a key role in regulating inflammation, immune functions, host defense, and apoptosis (PMID: 16407280). TNFA signals through two distinct cell surface receptors, TNFR1 (TNFRSF1A, CD120a, p55) and TNFR2 (TNFRSF1B, CD120b, p75). TNFR1 is widely expressed, whereas TNFR2 exhibits more restricted expression, being found on CD4 and CD8 T lymphocytes, endothelial cells, microglia, oligodendrocytes, neuron subtypes, cardiac myocytes, thymocytes and human mesenchymal stem cells (PMID: 20489699; 22374304). In contrast to TNFR1, TNFR2 does not have a death domain. TNFR2 only signals for antiapoptotic reactions. However, recent evidence indicates that TNFR2 also signals to induce TRAF2 degradation (PMID: 22374304). Various defects in the TNFR2 pathway, due to polymorphisms in the TNFR2 gene, upregulated expression of TNFR2 and TNFR2 shedding, have been implicated in the pathology of several autoimmune disorders (PMID: 20489699).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg0683 Product name: Recombinant mouse Tnfrsf1b protein Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 23-258 aa of NM_011610.3 Sequence: VPAQVVLTPYKPEPGYECQISQEYYDRKAQMCCAKCPPGQYVKHFCNKTSDTVCADCEASMYTQVWNQFRTCLSCSSSCTTDQVEIRACTKQQNRVCACEAGRYCALKTHSGSCRQCMRLSKCGPGFGVASSRAPNGNVLCKACAPGTFSDTTSSTDVCRPHRICSILAIPGNASTDAVCAPESPTLSAIPRTLYVSQPEPTRSQPLDQEPGPSQTPSILTSLGSTPIIEQSTKGG Predict reactive species\nFull Name: tumor necrosis factor receptor superfamily, member 1b\nCalculated Molecular Weight: 50KD\nGenBank Accession Number: NM_011610.3\nGene Symbol: Tnfrsf1b\nGene ID (NCBI): 21938\nRRID: AB_3672165\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q545P4\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888582152361,"sku":"98021-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-98021-1-rr","provider":"Iright","version":"1.0","type":"link"}