{"product_id":"proteintech-98197-1-rr","title":"Proteintech, 98197-1-RR, Anti-Mouse Neutrophil Elastase Rabbit Recombinant Antibody","description":"Size: 100ug\nThe Neutrophil Elastase (98197-1-RR) by Proteintech is a Recombinant antibody targeting Neutrophil Elastase in FC (Intra) applications with reactivity to mouse samples\n98197-1-RR targets Neutrophil Elastase in FC (Intra) applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC (Intra) detected in: mouse bone marrow cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in 100 μl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nELA2 (Neutrophil elastase) is also named as ELAL, NE, HLE, HNE, PMN-E, SERP1, GE, ELANE and belongs to the peptidase S1 family. It is a 33-kDa enzyme with several isoforms that differ in their extent of glycosylation (PMID:12223222). Human neutrophil elastase (HNE) is a serine protease with potent proteolytic activity (3), which is reported to cause mucin secretion (degranulation) (PMID:12169572). It may contribute to the directed migration of leukocytes into flamed postcapillary venules in addition to contributing to the process of tissue emigration (PMID:9683424).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg2126 Product name: Recombinant Mouse Neutrophil elastase protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 27-260 aa of NM_015779.2 Sequence: SEIVGGRPARPHAWPFMASLQRRGGHFCGATLIARNFVMSAAHCVNGLNFRSVQVVLGAHDLRRQERTRQTFSVQRIFENGFDPSQLLNDIVIIQLNGSATINANVQVAQLPAQGQGVGDRTPCLAMGWGRLGTNRPSPSVLQELNVTVVTNMCRRRVNVCTLVPRRQAGICFGDSGGPLVCNNLVQGIDSFIRGGCGSGLYPDAFAPVAEFADWINSIIRSHNDHLLTHPKDR Predict reactive species\nFull Name: elastase 2, neutrophil\nCalculated Molecular Weight: 29 kDa\nGenBank Accession Number: NM_015779.2\nGene Symbol: Ela2\nGene ID (NCBI): 50701\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q3UP87\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2 - 8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888578842793,"sku":"98197-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-98197-1-rr","provider":"Iright","version":"1.0","type":"link"}